contact | introductie | kalender | online-satsang | download | afbeeldingen | gedichten | Swami J artikelen | donaties ENGLISH

circle-chart tripura-leela-110X70zwarte rand3 START HIER
ÉÉN YOGA… Yoga, Vedanta, Tantra
Moeder Aarde, Kosmische Moeder, Divine Mother
Meditatie; een universeel proces
Verlangen, wensen, bhava in Yoga Meditatie

systematic meditation sequence-klein-zwarte randARTIKELEN OVER YOGA MEDITATIE
Systematische Yoga Meditatie
Yoga Meditation; a universal process
Verlangen, wensen, bhava in Yoga Meditation
8-voudig Pad van de Yoga Sutras & De 8 Stappen van Zelf-transformatie
4 keer per dag
Conscious Transition: Silent Meditation into Meditation in Action

INTRODUCTIE
Swami Ma TripurashaktiSwami JnaneshvaraSwami RamaAbhyasa AshramOnze Traditie

meme summaray of practices small meme Inspiring Yoga Messages SR small meme blending2 small meme yoga as meditation2 small

sriyantra--vierkant-smallNIEUW NIEUW NIEUW
Bindu

Bindu betekent punt of stip; het woord is afgeleidt van ‘bhid’ of ‘bhind’, dat betekent barsten, doorbreken. Het piercen, barsten, of doorbreken van de bindu (bindu vedhana) is de laatste stap van practice. Maar als je op dit punt bent aangekomen dan kan je het nauwelijks practice noemen, want dan is er alleen nog maar sprake van genade. De bindu is het transitie-punt van dualiteit in en naar Puur Bewustzijn. De bindu is de deur voorbij of uit de mind, want het concept of fenomeen van bindu is het punt vanwaaruit tijd, ruimte, causaliteit en alle andere concepten zijn gemanifesteerd. De bindu is het punt vanwaaruit multipliciteit lijkt te expanderen. En dus is de weg terug naar de bindu teruggaan naar de grens van ruimte, tijd en de ogenschijnlijke manifestatie; wat een punt is en niet een rand of oever. Het concept van de bindu kan gevonden worden in verschillende mystieke geschriften. De yogis, mystici, tantrics, en wijzen die Puur Bewustzijn hebben ervaren, spreken over het stuiten op dit punt–bijvoorbeeld gesymboliseerd als een mosterdzaadje–omdat er geen andere uitweg is! De bindu is het centrum van de Sri Yantra en de bindu is ook de stip in het symbool van AUM. lees meer

YOGISCH ZELF-BEWUSTZIJN ASSESSMENT
abhiniveshaahamkaraantahkaranaasmitaavidyabhavabhutasbuddhichittadveshaekagraelementengunaskleshaskshiptamanasmayamudhanidranirodhahpramanaragarajassattvasmrititamasvikalpavikshiptaviparyaya

favicon-zwarte rand2MELD JE AAN VOOR DE NIEUWSBRIEF
De Nederlandse en Engelse nieuwsbrief zijn samengevoegd
KLIK HIER OM JE OP TE GEVEN!

VOORBEREIDING MEDITATIE
ASANA TABEL
vooroverbuigingachteroverbuigingzijbuigingtwistheup-openerverlengenomgekeerde-houdingontspanningshouding-relaxation
asana voor meditatie


POSTER-SR-SMILES-small

| top |

YOGA MEDITATIE VOOR ZELF-REALISATIE

Deze site is een offer aan allen die een diep verlangen hebben om dat Pure Bewustzijn dat aanwezig is in al de drie staten van Waken, Dromen, en Diepe Slaap direct te ervaren, dit Puur Bewustzijn is ook wel bekend als Divine Mother (Goddelijke Moeder) of Tripura (‘Tri’ betekent drie en ‘pura’ betekent stad); want Ze is degene die in de drie steden van Waken, Dromen en Diepe Slaap woont. Deze drie steden/staten tijdelijk achterwegen laten en verblijven in Puur Bewustzijn wordt Zelf-realisatie genoemd. Een andere naam voor Zelf-realisatie is Yoga; de vereeniging van de individuele zelf met de Universele Zelf; de vereeniging van Atman met Brahman; of Shiva met Shakti; of het scheiden van Prakriti en Purusha. Sommige zullen misschien denken dat Tripura een antropomorfisch wezen is, maar dat is Ze niet, Ze is de Non-dualistische Realiteit waarin alle oogschijnlijke manifestatie lijkt te bestaan. Alles wat er is, is de Non-dualistische Realiteit.
 
De teachings van Yoga, Vedanta, en Sri Vidya Tantra worden op deze website aangeboden om je te begeleiden in het leren rechtstreeks te kunnen mediteren op Tripura door gebruik te maken van moderne communicatie middelen, zoals via animaties, terwijl de eeuwenoude wijsheid wordt behouden. Een eeuwenoude lijn van meditatie meesters, die we liefdevol “de Traditie van de meesters uit de Himalayas” noemen, heeft deze eeuwenoude wijsheid aan ons gegeven. Deze practices leiden ons naar een ruimte van stilte waarin Yoga meditatie, contemplatie, mantra en gebed samenkomen als diepe devotie en constant bewustzijn van Tripura. Gratie komt aan het einde van de reis, wanneer alle inspanningen zijn uitgeput. Dit heet shaktipata, waardoor de laatste barrière wordt verwijderd, dit is het doorboren van de bindu en leidt tot de directe ervaring van de Non-dualistische Realiteit. Dit onthult eindelijk de onvoorstelbare Vreugde die voorkomt uit het kennen van de Non-dualistische Realiteit of Puur Bewustzijn!