contact | introductie | kalender | online-satsang | download | afbeeldingen | gedichten | Swami J artikelen | donaties ENGLISH

circle-chart tripura-leela-110X70zwarte rand3 START HIER
ÉÉN YOGA… Yoga, Vedanta, Tantra
Moeder Aarde, Kosmische Moeder, Divine Mother
Meditatie; een universeel proces
Verlangen, wensen, bhava in Yoga Meditatie

systematic meditation sequence-klein-zwarte randARTIKELEN OVER YOGA MEDITATIE
Systematische Yoga Meditatie
Yoga Meditation; a universal process
Verlangen, wensen, bhava in Yoga Meditation
8-voudig Pad van de Yoga Sutras & De 8 Stappen van Zelf-transformatie
4 keer per dag
Bewuste Transitie: van Stilte Meditatie naar Meditatie in Actie

INTRODUCTIE
Swami Ma TripurashaktiSwami JnaneshvaraSwami RamaAbhyasa AshramAbhyasa Ashram NLOnze Traditie

meme summaray of practices small meme Inspiring Yoga Messages SR small meme blending2 small meme yoga as meditation2 small

sriyantra--vierkant-smallNIEUW NIEUW NIEUW
Chakras

(Een fragment van het artikel)Omdat Shakti tijdens haar ogenschijnlijke spel van manifestatie in slaapt lijkt te vallen in de Diversiteit, omdat de vormen zichzelf nu als los van elkaar lijken te ervaren en niet als Eén, is er dus een proces van “wakker worden” nodig. In een ogenschijnlijk individu wordt deze weg van zowel evolutie van de manifestatie als de involutie terug naar direct ervaren van Shakti en Shiva als Eénheid weerspiegelt in de subtiele ruggengraat. De reis van manifestatie begint symbolisch bovenaan bij de kruin en eindigt onderaan de subtiele ruggengraat. Geleidelijk aan, als de reis via de ruggengraat naar beneden wordt afgelegd, kunnen we zien hoe Shakti van subtiel naar grof een “jij” manifesteerd. Dit kunnen we zien aan alle fenomenen die zich onderweg manifesteren die te koppelen zijn aan de chakra’s. lees meer

YOGISCH ZELF-BEWUSTZIJN ASSESSMENT
abhiniveshaahamkaraantahkaranaasmitaavidyabhavabhutasbuddhichittadveshaekagraelementengunaskleshaskshiptamanasmayamudhanidranirodhahpramanaragarajassattvasmrititamasvikalpavikshiptaviparyaya

favicon-zwarte rand2MELD JE AAN VOOR DE NIEUWSBRIEF
De Nederlandse en Engelse nieuwsbrief zijn samengevoegd
KLIK HIER OM JE OP TE GEVEN!

VOORBEREIDING MEDITATIE
ASANA TABEL
vooroverbuigingachteroverbuigingzijbuigingtwistheup-openerverlengenomgekeerde-houdingontspanningshouding-relaxation
asana voor meditatie


POSTER-SR-SMILES-small

| top |

YOGA MEDITATIE VOOR ZELF-REALISATIE

Deze site is een offer aan allen die een diep verlangen hebben om dat Pure Bewustzijn, dat aanwezig is in al de drie staten van Waken, Dromen, en Diepe Slaap, direct te ervaren. Dit Puur Bewustzijn is ook wel bekend als Divine Mother (Goddelijke Moeder) of Tripura (‘Tri’ betekent drie en ‘pura’ betekent stad); want Ze is degene die in de drie steden van Waken, Dromen en Diepe Slaap woont. Deze drie steden/staten tijdelijk achterwegen laten en verblijven in Puur Bewustzijn wordt Zelf-realisatie genoemd. Een andere naam voor Zelf-realisatie is Yoga; de vereniging van de individuele zelf met de Universele Zelf; de vereniging van Atman met Brahman; of Shiva met Shakti; of het scheiden van Prakriti en Purusha. Sommige zullen misschien denken dat Tripura een antropomorfisch wezen is, maar dat is Ze niet, Ze is de Non-dualistische Realiteit waarin alle oogschijnlijke manifestatie lijkt te bestaan. Alles wat er is, is de Non-dualistische Realiteit.
 
De teachings van Yoga, Vedanta, en Sri Vidya Tantra worden op deze website aangeboden om je te begeleiden in het leren rechtstreeks te kunnen mediteren op Tripura door gebruik te maken van moderne communicatie middelen, zoals via animaties, terwijl de eeuwenoude wijsheid wordt behouden. Een eeuwenoude lijn van meditatie meesters, die we liefdevol “de Traditie van de meesters uit de Himalaya” noemen, heeft deze eeuwenoude wijsheid aan ons gegeven. Deze practices leiden ons naar een ruimte van stilte waarin Yoga meditatie, contemplatie, mantra en gebed samenkomen als diepe devotie en constant bewustzijn van Tripura. Gratie komt aan het einde van de reis, wanneer alle inspanningen zijn uitgeput. Dit heet shaktipata, waardoor de laatste barrière wordt verwijderd, dit is het doorboren van de bindu en leidt tot de directe ervaring van de Non-dualistische Realiteit. Dit onthult eindelijk de onvoorstelbare Vreugde die voorkomt uit het kennen van de Non-dualistische Realiteit of Puur Bewustzijn!